30-MINUTE MEALS! Get the email series now

Baked Boursin Salmon

5 from 1 vote
1 Comments
Anna collins
By: Anna collinsUpdated: Mar 5, 2026
This post may contain affiliate links. Please read our disclosure policy.

A simple, elegant baked salmon topped with creamy garlic and fine herbs Boursin for a weeknight dinner that feels special. Ready in about 30 minutes and perfect with roasted vegetables or a crisp salad.

Baked Boursin Salmon

This baked Boursin salmon became a weekday favorite the first time I tried it on a busy weeknight when guests were staying over. I wanted something that felt restaurant-worthy but required minimal hands-on time. The combination of tender, flaky salmon and the luscious, herb‑forward Boursin created a contrast of textures that felt indulgent without fuss. I discovered the balance of bright lemon zest and the savory, garlicky tang of the cheese while experimenting with pantry staples and classic herbs. Since then it has turned up at holiday dinners, casual family meals, and last-minute guests, always earning compliments and requests for the recipe.

What I love most about this dish is how the simple ingredients elevate each other. The oil-brushed salmon roasts to a buttery finish and the Boursin softens into a bubbly, golden topping that keeps the fish moist. The lemon adds a lift that prevents the cheese from feeling too heavy and the aromatics—fresh garlic and parsley—bring freshness to every bite. I often serve this with steamed green beans and warm lemon rice; it feels like a special-occasion plate but takes almost no time to assemble. It’s a technique that rewards accurate timing and modest prep, with excellent results even for cooks who are new to preparing fish.

Why You'll Love This Recipe

  • This dish is ready in roughly 30 minutes from start to finish, making it ideal for weeknights or last-minute dinners.
  • It uses pantry-friendly ingredients plus a single tub of Boursin, which creates a restaurant-style topping with almost no effort.
  • The method locks in moisture, so even lean fillets emerge tender and flaky instead of dry.
  • It’s highly adaptable: swap herbs, use butter instead of oil, or change citrus to suit seasonality and taste.
  • Make-ahead options include prepping the cheese mixture up to 24 hours ahead, speeding up evening assembly.
  • Crowd-pleasing and elegant, the plated result looks polished without complicated technique, perfect for family meals and casual entertaining.

I first served this when friends came by for an impromptu dinner. They expected something simple, and the Boursin-topped fillets vanished quickly. My partner still remembers the crunchy edges of the lightly browned cheese and how the herb notes tasted like a small luxury. Over time I learned which visual cues to watch for, how long to rest the fish, and how to pair sides that highlight the creamy topping rather than compete with it.

Ingredients

  • Salmon fillets: Use 4 fillets, about 5 to 6 ounces each. Look for even-thickness fillets with bright color and firm flesh. If buying skin-on, it helps keep the fish intact while baking; skinless works fine too. Sustainable wild or responsibly farmed Atlantic options both perform well.
  • Boursin cheese (garlic and fine herbs): One 5.2 ounce round. This flavored herbed cheese brings garlic, chives, parsley, and creaminess in one package so you avoid chopping many fresh herbs.
  • Olive oil or melted butter: 2 tablespoons. Either will add fat to help the salmon brown and the cheese to meld. Use extra-virgin olive oil for fruity notes or unsalted melted butter for a richer finish.
  • Garlic: 2 cloves, minced. Fresh garlic adds a sharp aromatic lift that complements the Boursin’s garlic profile; mince finely so it disperses into the topping.
  • Lemon: 1 tablespoon fresh lemon juice plus 1 teaspoon lemon zest. The brightness of citrus cuts the richness and gives each bite a clean finish. Use unwaxed lemons when zesting for best results.
  • Seasoning: Salt and freshly ground black pepper to taste. I use about 1/2 teaspoon kosher salt per fillet if skinless and slightly less for skin-on pieces; adjust based on preference.
  • Fresh parsley: A small handful, chopped, for garnish. Flat-leaf parsley supports the herbs in the cheese and adds a fresh color contrast on the plate.
User provided content image 2

Instructions

Preheat and prepare: Preheat the oven to 400°F. Lightly grease a medium baking dish or line it with parchment paper so cleanup is easy and the fillets won’t stick. Preheating ensures the fish begins cooking immediately for even doneness and a gentle crust on the topping. Make the cheese mixture: In a small bowl combine the entire 5.2 ounce round of Boursin with 2 cloves minced garlic, 1 teaspoon lemon zest, 1 tablespoon fresh lemon juice, and half of the 2 tablespoons olive oil or melted butter. Stir until smooth and homogeneous. If the Boursin is very cold, let it sit at room temperature for 10 minutes so it mixes evenly without lumps. Season the fillets: Pat each salmon fillet dry with paper towels to remove surface moisture; this promotes browning. Lightly drizzle the remaining oil over the fillets and rub to coat. Season both sides with salt and black pepper. Place the fillets skin-side down in the prepared baking dish, leaving a bit of space between them for even heat circulation. Top and bake: Using a small spoon or offset spatula, spread an even layer of the cheese mixture over the top of each fillet. Aim for about 1 to 2 tablespoons of mixture per fillet, enough to cover but not overload. Bake in the preheated oven 15 to 20 minutes, depending on thickness, until the internal temperature reaches 145°F and the cheese is lightly golden. Thicker fillets may need up to 20 minutes; thinner ones will finish closer to 15 minutes. Rest and garnish: Remove from the oven and let the fish rest 3 to 5 minutes. Resting allows carryover cooking to settle and juices to redistribute. Sprinkle chopped fresh parsley and an extra squeeze of lemon if desired, then serve immediately with your chosen sides. User provided content image 1

You Must Know

  • This plate is high in protein and healthy fats; it reheats well for leftovers and freezes poorly because the cheese texture changes after freezing.
  • Store cooked leftovers in an airtight container in the refrigerator for up to 2 days; reheat gently in a warm oven to avoid overcooking the salmon.
  • The fillets are best when the interior reaches 145°F; use an instant-read thermometer to avoid overcooking and drying the fish.
  • Adjust the baking time by thickness; 3/4 inch fillets need about 15 minutes, while 1 inch or thicker may need 18 to 20 minutes.

My favorite aspect of this method is the confidence it gives me when cooking fish for guests. The topping insulates and flavors the salmon so even someone nervous about timing can achieve tender results. Friends have told me they thought I used a complicated culinary technique, when in reality the magic comes from a short list of quality ingredients and careful timing.

Storage Tips

Cool leftovers to room temperature no longer than two hours after cooking, then cover and refrigerate. Stored in an airtight container the fillets will maintain quality for up to 2 days. To reheat, place in a 300°F oven for 8 to 12 minutes until just warmed through to avoid additional drying. Freezing is not recommended because the Boursin’s texture separates and becomes grainy after thawing; if you must freeze, wrap tightly in plastic and foil and use within one month. When reheating from frozen, thaw overnight in the refrigerator and reheat gently in a low oven.

Ingredient Substitutions

If Boursin is unavailable, mix 4 ounces of cream cheese with 1 tablespoon chopped fresh chives, 1 tablespoon chopped parsley, 1 clove minced garlic, and a pinch each of dried herbs like thyme and chives; adjust salt to taste. Use unsalted butter if you prefer a richer edge instead of olive oil. For a dairy-free version, blend a cashew-based cream with chopped herbs and garlic, though note the topping will be less tangy. Swap lemon for a touch of white wine if you prefer a different acid profile; use about 1 tablespoon.

Serving Suggestions

Serve the fillets alongside buttery new potatoes, lemon rice, or a crisp green salad dressed with a light vinaigrette to balance the topping. Roasted asparagus, green beans, or a medley of roasted root vegetables complement the herb flavors. Garnish with extra parsley, lemon wedges, or a scattering of chopped chives for a professional finish. For a dinner party plate, serve family-style with a tray of seasonal vegetables and slices of crusty bread to soak up the lovely melted cheese.

Cultural Background

This preparation blends French-style herbed cheese with simple roasting techniques common in modern American and European kitchens. While not a traditional dish from a specific region, it borrows elements of French fromage aromatique and the universal practice of baking fish with a savory crust. Using a pre-flavored cheese simplifies the layering of flavors and reflects contemporary comfort cooking that prizes convenience without sacrificing depth.

Seasonal Adaptations

In spring and summer, pair the fillets with fast-sautéed greens, peas, or a cucumber and dill salad for brightness. In autumn and winter, swap the lemon for a drizzle of warm browned butter and serve with roasted squash and hearty grains. During citrus season, try Meyer lemon zest for a sweeter, floral lift. Herbs can be adjusted to reflect seasons: tarragon in spring, rosemary in winter, or a mixture of chives and chervil when available.

Meal Prep Tips

Prepare the cheese mixture up to 24 hours ahead and refrigerate in a sealed container. Portion salmon fillets into the baking dish and bring them to room temperature for 15 minutes before baking to ensure even cooking. If prepping multiple portions for the week, cook just enough for two nights and assemble fresh for the remaining meals to maintain texture. Use shallow, well-sealed containers for refrigerated storage to preserve aroma and moisture.

Ultimately, this baked Boursin salmon is a reliable dish that looks refined and tastes fresh. It is easy enough for a weekday and special enough for guests, and with small adjustments you can make it fit any season or occasion. Try it once and you will find the small techniques that make it your own.

Pro Tips

  • Pat the salmon dry before oiling to promote browning and prevent steaming.

  • Let the Boursin sit at room temperature for 10 minutes before mixing for a smoother topping.

  • Use an instant-read thermometer and pull the fish at 145°F for ideal doneness.

  • Prepare the cheese mixture the day before to save time on busy evenings.

  • If fillets are uneven, fold a small piece of foil under thinner ends so everything cooks evenly.

This nourishing baked boursin salmon recipe is sure to be a staple in your kitchen. Enjoy every moist, high protein slice — it is perfect for breakfast or as a wholesome snack any time.

Tags

Quick & Easy Recipesrecipemain courseseafooddinnerweeknightfamily-friendly
No ratings yet

Baked Boursin Salmon

This Baked Boursin Salmon recipe makes perfectly juicy, tender, and flavorful steak every time! Serve with potatoes and a side salad for an unforgettable dinner in under 30 minutes.

Servings: 4 steaks
Baked Boursin Salmon
Prep:10 minutes
Cook:20 minutes
Rest Time:10 mins
Total:30 minutes

Ingredients

Main

Seasoning & Aromatics

Instructions

1

Preheat and prepare

Preheat oven to 400°F. Lightly grease a baking dish or line with parchment paper to prevent sticking and aid cleanup.

2

Make the cheese mixture

Combine the 5.2 ounce Boursin, minced garlic, lemon zest, lemon juice, and half of the olive oil until smooth. If very cold, let Boursin sit 10 minutes to soften for easier mixing.

3

Season the fillets

Pat salmon dry, drizzle with remaining oil, and season with salt and pepper. Place skin-side down in the dish, spacing fillets slightly apart for even heat circulation.

4

Top and bake

Spread an even layer of the cheese mixture over each fillet, about 1 to 2 tablespoons per fillet. Bake at 400°F for 15 to 20 minutes until internal temperature reaches 145°F and cheese is lightly golden.

5

Rest and serve

Allow the fillets to rest for 3 to 5 minutes, garnish with chopped parsley and a lemon wedge, and serve immediately with sides of your choice.

Last Step: Please leave a rating and comment letting us know how you liked this recipe! This helps our business to thrive and continue providing free, high-quality recipes for you.

Nutrition

Calories: 420kcal | Carbohydrates: 2g | Protein:
36g | Fat: 28g | Saturated Fat: 8g |
Polyunsaturated Fat: 6g | Monounsaturated Fat:
11g | Trans Fat: 1g | Cholesterol: 253mg | Sodium:
0mg | Potassium: 953mg | Fiber: 0g | Sugar:
0g | Vitamin A: 577IU | Vitamin C: 3mg | Calcium:
47mg | Iron: 6mg

Did You Make This?

Leave a comment & rating below or tag
@highrecipe on social media!

Baked Boursin Salmon

Categories:

Baked Boursin Salmon

Did You Make This?

Leave a comment & rating below or tag @highrecipe on social media!

Rate This Recipe

Share This Recipe

Enjoyed this recipe? Share it with friends and family, and don't forget to leave a review!

Comments (1)

Leave a Comment

0/1000 characters
Food Lover
1 day ago

This recipe looks amazing! Can't wait to try it.

Rating:

Comments are stored locally in your browser. Server comments are displayed alongside your local comments.

Family photo

Hi, I'm Anna!

Chef and recipe creator specializing in delicious Quick & Easy Recipes cooking. Passionate about sharing easy-to-follow recipes that bring families together around the dinner table.

30-Minute Meals!

Join to receive our email series which contains a round-up of some of our quick and easy family favorite recipes.